[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50036.1"

            "transcriptional regulator, AraC family"
            ""

OrgPattern -------------------------------------------------------------------- ----11-------------------------------1-------1--------------1-1-1--112-1----------------3324-1------1----424-2------------------------1---------1-511---------------1---11------------------11--25334332251444233CE6534444254B311222222C*------------------2-3-1----1---11-----131-11231212---111------------------------111---11119731D434444354592332222D-51--24--4312-1---22-1D--1--2---------223-----1--------------1---1-----21--3221---11-131-----2-1-11--1---------------1-------------------------------1---------11---1--------1111112---11---111--------1---1---------------1--2--2--1--1--1--1-11--1-2----1-------11-----------------1-----233-111131-2-----------2111--1---------------2---1111111112--1111121111112111111231--1--2-112222221121121211------1--------------------11-1-1723---11--1111----111-1-1-212-33333344622255222-----------11211111-2233-----------------------------------------------------------------------2- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------7------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDN:Sequence : EEEcEEcccEEEEEEEEEEEEEETTEEEEEETTcEEEEcTTcc:Sec Str : ========================================:RP:SCP|21->151|1sfnA|3e-09|12.9|124/245|b.82.1.11 :============================================================:BL:SWS|1->235|YOBQ_BACSU|7e-44|38.1|231/241 61: . . . * . .: 120 :HTFYSKDKNEFLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNP:Sequence :EEEEEEEEEEEEEEEcHHHHccGcccTTcEEEcTccccGGG :Sec Str :============================================================:RP:SCP|21->151|1sfnA|3e-09|12.9|124/245|b.82.1.11 :============================================================:BL:SWS|1->235|YOBQ_BACSU|7e-44|38.1|231/241 121: . . + . . .: 180 :SLHDLFRYASRLLYNFDQPVSIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLS:Sequence : HHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHccc:Sec Str :=============================== :RP:SCP|21->151|1sfnA|3e-09|12.9|124/245|b.82.1.11 : =======================================:RP:SCP|142->238|1v4aA1|1e-16|10.3|97/151|a.24.16.4 :============================================================:BL:SWS|1->235|YOBQ_BACSU|7e-44|38.1|231/241 181: . * . . . .: 240 :PLAFIQKLRLEKAKYLLINTDFSLLRIAQEVGYEQQSSLARLFRQKEGMSASDYRKAFQR:Sequence :HHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccc:Sec Str : ########################################### :PROS|189->231|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| :========================================================== :RP:SCP|142->238|1v4aA1|1e-16|10.3|97/151|a.24.16.4 :======================================================= :BL:SWS|1->235|YOBQ_BACSU|7e-44|38.1|231/241 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|197->235|PF00165|1e-06|43.6|39/40|HTH_AraC