[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50098.1"

            "inner-membrane translocator"
            ""

OrgPattern -------------------------------------------------------------------- -----1-1111------------------------------1-------------11-----------------------------------------------------------------------------1---------------------------------------------------------1----------------1--------1221---------11--------------------112122-1111221122111111---22212222111111111212111111112111111322222222--1-12222222-21-211-------1-1-2--33-3111--------11-------111-1-------------11111111111---------11--111-11-11111------------------------------1------------1111-11--1111----------111-1-1111--1111111-1111111-21121--1111-1111-------------1-----------1---1-111---1---11-1--1----------1-------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------1-------------1----------111--1111--------------------------11111111-11-----------------1-------------------------------------------11---1----1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTSIWLGVLEQGLLWGVMVLGVYITFRVLDFPDLTVDGSFTLGAAVAARMIIEGQDPWL:Sequence : X:SEG|60->79|lgtllalfagaaagfvtgfl : =========================================================:BL:SWS|4->209|Y368_RICPR|4e-17|37.9|195/280 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->279|PF02653|6e-09|24.6|260/271|BPD_transp_2 61: . . . * . .: 120 :GTLLALFAGAAAGFVTGFLNTRLRIAPLLSGILMMIALYSINLRVMGNKSMISLLRMDNI:Sequence :XXXXXXXXXXXXXXXXXXX :SEG|60->79|lgtllalfagaaagfvtgfl :============================================================:BL:SWS|4->209|Y368_RICPR|4e-17|37.9|195/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->279|PF02653|6e-09|24.6|260/271|BPD_transp_2 121: . . + . . .: 180 :YTDVANIGVPAGMAVLTFGLVIITLTTYLLYAFLQTEIGMALRATGDNEQMIRSLGVNTN:Sequence : XXXXXXXXXX :SEG|142->151|iitlttylly :============================================================:BL:SWS|4->209|Y368_RICPR|4e-17|37.9|195/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->279|PF02653|6e-09|24.6|260/271|BPD_transp_2 181: . * . . . .: 240 :STKILGLSMGNALVAMSGALVAQYQSYSDVGMGIGMIVVGLASVIVGEVVIGKRTLLRTL:Sequence : XXXXXXXXXXX :SEG|210->220|vgmgigmivvg :============================= :BL:SWS|4->209|Y368_RICPR|4e-17|37.9|195/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->279|PF02653|6e-09|24.6|260/271|BPD_transp_2 241: + . . . . *: 300 :VAVLIGSIIYRAVIAAVMQLGLPTTDLKLFTALLVIFAMSSPLIKEKLSAPPGRAKGSVD:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->279|PF02653|6e-09|24.6|260/271|BPD_transp_2 301: . . . . + .: 360 :HAVNSGN :Sequence