[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50103.1"

            "binding-protein-dependent transport systems inner membrane component"
            ""

OrgPattern ----1------------------1--------11-1111122132221112121-------------1 -1-12--1113---433----2---9------23337A85-315311--11-624111--11--4244253-111---1--12----1----------------------1-------11111111---1-----122221---34213222322342-1--13323533-1-----------111--21-1-33333344443434448133214331-32---1111112A111111111111111-1111--1-22---------32--1-11----------1221111-111111--------------11---111-11228111233212124882111214--31---87152-2--61111--1--1222------55HJT-35922C455545454547-CBFA9CBA6B1-MAA9867B9B65JE1--5382634424323333331---24-------------------------------1-11-15GDA53ACCB333443888744443295PA6B7-3774254125653FE26-162411-------21-1231251221-111--2127--2-31-222219151221----------------12-1---2121122-2-2---------------------1-311------6475-342222222222-2222222212222222222464781112212222222222222311221221-244444424444--------------2232-----1-111-1--15554513--1A686577876357454554---------2-11------232111-2-1------------4-------------------------------------------11--11111--2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------------------2--2---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHYLKGFVIPFVILILWLIGSATESINQYIIPPPTKVLQTALDLTASGILLKHITISLYR:Sequence : :Sec Str : =========================:RP:SCP|36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1 : ==========================================================:BL:SWS|3->244|SSUC_BACSU|4e-37|32.2|242/276 61: . . . * . .: 120 :VFAGFLLTVLFAFPLAILVGINQRLAPYIDPVLDFLGHIPPISCIPILILWFGIGETSKL:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|99->110|ippiscipilil :============================================================:RP:SCP|36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1 :============================================================:BL:SWS|3->244|SSUC_BACSU|4e-37|32.2|242/276 121: . . + . . .: 180 :AVIILATFFPVFLNTLNGILGCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLG:Sequence : TTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHH :Sec Str :============================================================:RP:SCP|36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1 :============================================================:BL:SWS|3->244|SSUC_BACSU|4e-37|32.2|242/276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->205|PF00528|6e-04|30.6|62/195|BPD_transp_1 181: . * . . . .: 240 :LGYSWRSLIGAELIAASSGIGYMIIDAEQLSRPDIIIVGILTIGLFGYIIDYCFFKLTNH:Sequence : :Sec Str :============================================================:RP:SCP|36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1 :============================================================:BL:SWS|3->244|SSUC_BACSU|4e-37|32.2|242/276 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|144->205|PF00528|6e-04|30.6|62/195|BPD_transp_1 241: + . . . . *: 300 :LIPWAGKRVSYGRS :Sequence : :Sec Str :======= :RP:SCP|36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1 :==== :BL:SWS|3->244|SSUC_BACSU|4e-37|32.2|242/276