[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50103.1 dred0 ABO50103.1 "binding-protein-dependent transport systems inner membrane component"
MHYLKGFVIPFVILILWLIGSATESINQYIIPPPTKVLQTALDLTASGILLKHITISLYR
VFAGFLLTVLFAFPLAILVGINQRLAPYIDPVLDFLGHIPPISCIPILILWFGIGETSKL
AVIILATFFPVFLNTLNGILGCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLG
LGYSWRSLIGAELIAASSGIGYMIIDAEQLSRPDIIIVGILTIGLFGYIIDYCFFKLTNH
LIPWAGKRVSYGRS
//