[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50205.1"

            "major facilitator superfamily MFS_1"
            ""

OrgPattern ------111111111-----------2---1---11--------2-1111111--------------- -21-1-----1---211----11112-----111111131------1--------1-------------------------------------------------1-11---------------------1--1-122211---1---1--------------1------1-------------21----11-422423223-2232324344243231124221222322441321222211222122--31221-----21222----1-112-111--------11-------------------------------------1----------11-11-111-----1--2143112113-1---------13--1---1-----1----3---11111111112-1--1-----1213--144-43321-111121--1--111------------1-1-----------11-------------------2--11---3245463211111112111111711-11---111---11-------1-11--1-11-1111111-1--11112-1--111221--111-11----1-----1------------------------33112---1-----1-----------------------------1---1-1111111111-1111111111111111111--11--211111111111111111-1111111-----------------1-----12121-11----------------222221-11-1-----211-11-1--121-211122121---11111123112------------------------------------------------------------11---11111--- ----------------------1---1211111-------------1---11-1--1-----1---------------------------------1--1------------2----------------------------------------------11-------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSQAASTDIQENKVNKYTLAALAGVPLIMVLGNSMLIPVLPQMAKSLNVSQMQISLIITL:Sequence : HHHHHHHHHHHHHHTTcccTTHHHHHHHHH:Sec Str : ============================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 : ==============================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 61: . . . * . .: 120 :FSVPAGLVIPFAGFLSDRFGRKKIIIPGLFLYGLGGLLAGAAALIFKENAFPWILGGRIL:Sequence :HHHHHHHHHTTHHHHHTTcccccccHHHHHHH :Sec Str : XXXXXXXXXXXX :SEG|93->104|glggllagaaal : ################# :PROS|72->88|PS00216|SUGAR_TRANSPORT_1|PDOC00190| :============================================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :============================================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 121: . . + . . .: 180 :QGIGAAGTAPIAMAFCGDLWKGKERAKSLGVIEASNGLGKVASPILGALIGLIAWWYIFF:Sequence : :Sec Str : XXX:SEG|178->190|iffffpvviavvi :============================================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :============================================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 181: . * . . . .: 240 :FFPVVIAVVILGVWFICKEPETNKQPKKVNEYVGSIKNIFKKKSPLLLTSFFAGSAALLI:Sequence : :Sec Str :XXXXXXXXXX :SEG|178->190|iffffpvviavvi :============================================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :============================================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 241: + . . . . *: 300 :LFGVLFFLSDYLEKKFGLDGVIKGAALAIPVLFMSTTSYVTGALIKKKIKLMKWLVVIGH:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|284->298|likkkiklmkwlvvi :============================================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :============================================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 301: . . . . + .: 360 :GLIGASLVTLPLFNNVYIFFAGISVAGIGTGLVLPCLNTLITSSTNKDERGLVTSLYGSV:Sequence : :Sec Str :============================================================:RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :============================================================:BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|31->342|PF07690|5e-21|29.6|301/347|MFS_1 361: . . . * . .: 420 :RFLGVAAGPPLFGWLVEKGSDMMFWASASLAVISAVLAFFFIKVKAIQTSQGNNYDSSKQ:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|386->398|asaslavisavla :========================= :RP:SCP|17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1 :======================== :BL:SWS|15->384|YITG_BACSU|7e-83|46.1|369/422 421: . . + . . .: 480 :KQSKQTLIMPVKQPFIAYKSLAWHPESNLIVRKPMPQMKKERINEVGQVNTGES :Sequence : :Sec Str