[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50272.1"

            "Radical SAM domain protein"
            ""

OrgPattern -------------------------------------------------1111--------------- -----------------------------------------------------------------------------------11------------------------------------------------1------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------1---------------1------------11--1--1----1----1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111--1---------------------------------------11111-1111111111111---------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNP:Sequence : EEEEEEEcccccccTTcTTcTTccccccccccHHHHHHHHHHHHHTT:Sec Str : ==============================================:RP:SCP|15->178|1tv7A|2e-11|24.1|158/327|c.1.28.3 : ================================================:BL:SWS|13->138|MOAA_META3|2e-07|35.3|116/299 61: . . . * . .: 120 :QSYNEIVFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLI:Sequence :TcccEEEEEEcccGGGTTHHHHHHHHHHHTTcccEEEEEccccHHHccHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|15->178|1tv7A|2e-11|24.1|158/327|c.1.28.3 :============================================================:BL:SWS|13->138|MOAA_META3|2e-07|35.3|116/299 121: . . + . . .: 180 :DTMSISLNAQNATVYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEAC:Sequence :cEEEcccccccHHHHHHHcTTcccTccHHHHHHHHHHHHTTcEEEEccEEccTTccHHHH:Sec Str :========================================================== :RP:SCP|15->178|1tv7A|2e-11|24.1|158/327|c.1.28.3 :================== :BL:SWS|13->138|MOAA_META3|2e-07|35.3|116/299 181: . * . . . .: 240 :ETIAQNLGTEFRLRKPTL :Sequence :HHHHHGGGHHH :Sec Str