[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50272.1 dred0 ABO50272.1 "Radical SAM domain protein"
MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNP
QSYNEIVFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLI
DTMSISLNAQNATVYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEAC
ETIAQNLGTEFRLRKPTL
//