[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50352.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSEHKYTSIDELIKKSLKERAQKETDVDMDLAWEKFNNKYNSKPKFTSKWTGIACSLVFL:Sequence 61: . . . * . .: 120 :LVAGLCFLPKEGTALNLKFLETIKSFVAGKVQTAQISFSTQEKEKDLENSLKPEVAQALK:Sequence : ==========================================================:BL:SWS|63->176|KTHY_ASFM2|5e-04|24.8|113/100 121: . . + . . .: 180 :EVPYEVLLPADLTGQYNLEKAMTQKVGDSTKVMLFLKTTNSELVNISEINIIGDFNQATS:Sequence :======================================================== :BL:SWS|63->176|KTHY_ASFM2|5e-04|24.8|113/100 181: . * . . . .: 240 :YDTEDAVLEKVNVKGQNANLLTFKDGKKQLCWVDRDVFVTITGPLNQENLFILATSLRRV:Sequence 241: + . . . . *: 300 :NLQ :Sequence