[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50352.1 dred0 ABO50352.1 "hypothetical protein"
MSEHKYTSIDELIKKSLKERAQKETDVDMDLAWEKFNNKYNSKPKFTSKWTGIACSLVFL
LVAGLCFLPKEGTALNLKFLETIKSFVAGKVQTAQISFSTQEKEKDLENSLKPEVAQALK
EVPYEVLLPADLTGQYNLEKAMTQKVGDSTKVMLFLKTTNSELVNISEINIIGDFNQATS
YDTEDAVLEKVNVKGQNANLLTFKDGKKQLCWVDRDVFVTITGPLNQENLFILATSLRRV
NLQ
//