[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50378.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------222222222222222----11222121--11------11----------------------------------------------------------------------------------------------11112111111-----221----2---1-11-211---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------1----------------------------------------------------1--1111111111-1111111111111111111111----------------------1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKHPILLVIFFTVCFFYLWGNEVLNIFKIVFSSDIQKAVELIRTAGSKAVLISIFINVA:Sequence : =======================================:BL:SWS|22->221|YDJZ_ECOLI|2e-15|27.0|196/235 61: . . . * . .: 120 :ISLMGVMPSVFLTGANLIIFGLNKGFLVSWAGEVIGAAISFLLYRWGITSVAKLSTEQWK:Sequence :============================================================:BL:SWS|22->221|YDJZ_ECOLI|2e-15|27.0|196/235 121: . . + . . .: 180 :LFKTINSLPPLKQTYFLFILRMAPFIPSGLINLFGAITSVSLLNFLIATTAGKFPALLLE:Sequence :============================================================:BL:SWS|22->221|YDJZ_ECOLI|2e-15|27.0|196/235 181: . * . . . .: 240 :TAFSYHLITLGRNYIYVGISILIALLLYLGIKKEMRRLEKQYE :Sequence :========================================= :BL:SWS|22->221|YDJZ_ECOLI|2e-15|27.0|196/235