[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50378.1 dred0 ABO50378.1 "conserved hypothetical protein"
MRKHPILLVIFFTVCFFYLWGNEVLNIFKIVFSSDIQKAVELIRTAGSKAVLISIFINVA
ISLMGVMPSVFLTGANLIIFGLNKGFLVSWAGEVIGAAISFLLYRWGITSVAKLSTEQWK
LFKTINSLPPLKQTYFLFILRMAPFIPSGLINLFGAITSVSLLNFLIATTAGKFPALLLE
TAFSYHLITLGRNYIYVGISILIALLLYLGIKKEMRRLEKQYE
//