[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50573.1"

            "signal recognition particle subunit FFH/SRP54 (srp54)"
            ""

OrgPattern 22222222111222222222222222222222222222222222222222222222222222222-22 2232222222222222222-22222222222222222222222222122222222222222222222222222222222222223332222222222--222222222222222222222222222222222222222222---2223222222222222222222222222222222222222222222-32232323233333333322332233323233223333333322222222222222132222221222222222222222222222122222222222222222222222222222222222222222222233333333333333333333222333223333333323333333333322222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222223223333333333333323333333332232322332222222222322222233222222222222222232233222222222222233333222222332323222222323222222223333223322332322233333332333333223222-2222322222222222222222222222-22222222222222222222222222222222222222222222222221222222222222222222222222222222323222222222222222222122222223222233333333333332222222223233222222222322222222222222222221111112222222222222222-22222222222222222222223332323222 2222223-622222222222222222222212222222112222223222222221222222222222222-2222222222222222-22222222222222222223533422222132122332312C2-2232221212222222222232233224522223223812324444s44444569D2664432224 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAV:Sequence :ccTHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHH:Sec Str : =======================================================:RP:SCP|6->192|1uf2A|1e-36|14.1|185/967|e.28.1.2 : ===========================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->82|PF02881|4e-06|47.7|65/74|SRP54_N 61: . . . * . .: 120 :GQDVLESLSPAQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKL:Sequence :HccccTTccHHHHHHHHHHHHHHHHTTcccccccccccccEEEEEEccTTccHHHHHHHH:Sec Str :============================================================:RP:SCP|6->192|1uf2A|1e-36|14.1|185/967|e.28.1.2 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->82|PF02881|4e-06|47.7|65/74|SRP54_N : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->293|PF00448|1e-56|55.7|194/196|SRP54 121: . . + . . .: 180 :AKLLSKQGRRPLMVAGDIYRPAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANST:Sequence :HHHHHTTTccEEEEEcccccTHHHHHHHHHHGGGTcEEEccTTccHHHHHHHHHHHHHHT:Sec Str :============================================================:RP:SCP|6->192|1uf2A|1e-36|14.1|185/967|e.28.1.2 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->293|PF00448|1e-56|55.7|194/196|SRP54 181: . * . . . .: 240 :GRDLVIIDTAGRLHINEELMDELANIKSTVRPHEILLVVDAMTGQEAVNVADTFNQKLGL:Sequence :TccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEGGGGGGHHHHHHHHHHccTT:Sec Str :============ :RP:SCP|6->192|1uf2A|1e-36|14.1|185/967|e.28.1.2 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->293|PF00448|1e-56|55.7|194/196|SRP54 241: + . . . . *: 300 :DGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDALEPFYPDRMADRILGMGDVLT:Sequence :EEEEEEcccccccHHHHHHHHHTTcccEEEEEccccTTcEEEccHHHHHHHHTTTTcHHH:Sec Str : ############## :PROS|267->280|PS00300|SRP54|PDOC00272| : =====:RP:SCP|296->428|1qzwA2|5e-42|30.8|133/138|a.36.1.1 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|100->293|PF00448|1e-56|55.7|194/196|SRP54 301: . . . . + .: 360 :LIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGMIPGMGKLTKQ:Sequence :HHHHHHHHTTHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTccccccHHHHHHHccGGGc:Sec Str :============================================================:RP:SCP|296->428|1qzwA2|5e-42|30.8|133/138|a.36.1.1 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|326->425|PF02978|2e-27|64.0|100/101|SRP_SPB 361: . . . * . .: 420 :LKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ:Sequence :ccHccccHHHHHHHHHHHTTccHHHHHcGGGccHHHHHHHHHHHTccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|296->428|1qzwA2|5e-42|30.8|133/138|a.36.1.1 :============================================================:BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|326->425|PF02978|2e-27|64.0|100/101|SRP_SPB 421: . . + . . .: 480 :TRKMMKQISNMTKGGKKGKMKLPFFQ :Sequence :HHHHHHTcccc :Sec Str : XXXXXXXXX :SEG|433->441|kggkkgkmk :======== :RP:SCP|296->428|1qzwA2|5e-42|30.8|133/138|a.36.1.1 :============ :BL:SWS|2->432|SRP54_BACSU|e-150|61.4|430/446 :$$$$$ :RP:PFM|326->425|PF02978|2e-27|64.0|100/101|SRP_SPB