[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50573.1 dred0 ABO50573.1 "signal recognition particle subunit FFH/SRP54 (srp54)"
MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAV
GQDVLESLSPAQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKL
AKLLSKQGRRPLMVAGDIYRPAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANST
GRDLVIIDTAGRLHINEELMDELANIKSTVRPHEILLVVDAMTGQEAVNVADTFNQKLGL
DGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDALEPFYPDRMADRILGMGDVLT
LIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGMIPGMGKLTKQ
LKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
TRKMMKQISNMTKGGKKGKMKLPFFQ
//