[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50700.1"

            "selenocysteine-specific translation elongation factor SelB"
            ""

OrgPattern 22222223322333331222332333333333223333333332222223223522222232323222 3452742333333354433-3322443333333555565532243234322233343222343223544332333232223244332232222211111122122222422222222222111112222223322434433222442222222222211111322222221121211121211333223342222222232322333333222223332223322333332232322222222223222333222223322222332222322332233332233332233343434433222222222222234333363433544455555553532455455433334333444445444443335343414344444444444344336444455555555555623353343355544445445444675425523544542322222222232233434333333332233121111111111122222334444443355565555555555555554566555643444444333433333444344445333443344444524344544343223466565565343445334322223343332222232224241355554344334434455534455544555443212454322233355444545555555555-55555555555555555565554445555555555555555555555555541545455545555332433333333342443444545444434334444344433344555555434555552222332233232444544444444344444444444444433433334332222222232222223-21222322222223232222222222222343 47127561FB936676677577788976655556756646666645666666764556566656656647765565534555666675-788666666646769BD2869N8OCEDA62765A6EB2H5M*A1CCF3593M49DA75376D42A4987A8EK7A8A5F957EB798667*97677HFRN6D868B8995 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVD:Sequence :ccEEEEEEEccTTccHHHHHHHHHHHHHHHHcccccccGGGcTTEEEEEcccccEEEEEE:Sec Str : ################ :PROS|29->44|PS00301|EFACTOR_GTP|PDOC00273| : ================================:RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->167|PF00009|2e-22|40.6|160/183|GTP_EFTU 61: . . . * . .: 120 :VPGHEKFIKNMLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMV:Sequence :ccccGGGHHHHHHHHTTcccEEEEEETTTcccHHHHHHHHHHHHHTcccEEEEEEcGGGc:Sec Str :============================================================:RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->167|PF00009|2e-22|40.6|160/183|GTP_EFTU 121: . . + . . .: 180 :DEEWLSLVTEEIREYLKDTVLSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKL:Sequence :cHHHHHHHHHHHHHHHHTccTTTccEEEccHHHHHTTcHHHHHHHHHHcccccccTTccc:Sec Str :============================================================:RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->167|PF00009|2e-22|40.6|160/183|GTP_EFTU 181: . * . . . .: 240 :RLPIDRVFSVTGFGTVVTGTLLSGRVSTGDTVEIMPLGTVSRVRSIQVHGKKVEQARAGQ:Sequence :EEEcccEEEETTTEEEEEEEccccEEETTcEEEEEcccEEEEEEEEEETTEEEcEEETTc:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|187->204|vfsvtgfgtvvtgtllsg :============================================================:RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 241: + . . . . *: 300 :RTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLESAEKPLKNRARVRLYLGTDE:Sequence :EEEEEEEcccGGGccTTcEEEcTTccEEEEEEEEEEEEccGGGccEETTcccEEEETTEE:Sec Str :============================================================:RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 301: . . . . + .: 360 :ILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGGGVVIEPNAPK:Sequence :EEEEEccTTccEEcTTcEEEEEEEEEEEEEEcTTcEEEEEETTccEEEEEEEEEEEccGG:Sec Str :============== :RP:SCP|29->314|1c82A1|1e-28|14.2|274/370|a.102.3.2 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 361: . . . * . .: 420 :HKRYRSEVLEGLATKEKGTPEELVNQLLAGKQGLFSPEEIIEATGLAGDDLKISIEKLQS:Sequence :TEEccEccHHHHTccHHHHHHHHHHcTTTHHHHccccccEEccTTccEccHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 421: . . + . . .: 480 :EQQVKCIPVDKKSLYIAQFTYNKWRQEIKSMVINYHREYPLREGYPKEELRSRKFPFINN:Sequence :HHcEEEEEETTEEEEEEHHHHHHHHHHHHHHHHHHHHHcTTcccEEHHHHHHHHcTTccH:Sec Str : ========================================:RP:SCP|441->509|1lvaA2|2e-09|40.6|69/73|a.4.5.35 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|451->497|PF09106|2e-07|48.9|47/58|SelB-wing_2 481: . * . . . .: 540 :KHFQYLLQAMEIDGLLKLHDKTLALAEFTGELSGSQQKLVQDMICAIQEGNFQPPSWVEV:Sequence :HHHHHHHHHHHHTTcEEEETTEEEETTccccccHHHHHHHHHHHHHHHHHTTccccHHHH:Sec Str :============================= :RP:SCP|441->509|1lvaA2|2e-09|40.6|69/73|a.4.5.35 : =======================:RP:SCP|518->570|1wsuC1|7e-04|41.9|43/48|a.4.5.35 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 :$$$$$$$$$$$$$$$$$ :RP:PFM|451->497|PF09106|2e-07|48.9|47/58|SelB-wing_2 541: + . . . . *: 600 :VKKFRLKDAESQEYLQYFLRTGQLVKLSDDELYYTADRYQQAKTKIVEYLKENKEISVAQ:Sequence :HHHTTccHHHHHHHHHHHHHTTcEEEccccccEEEHHHHHHHHHHHHHHHHTTccccHHH:Sec Str :============================== :RP:SCP|518->570|1wsuC1|7e-04|41.9|43/48|a.4.5.35 : ================:RP:SCP|585->634|1lvaA4|1e-07|44.0|50/60|a.4.5.35 :============================================================:BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 : $$$$$$$$$$$$$:RP:PFM|588->634|PF09107|1e-11|61.7|47/50|SelB-wing_3 601: . . . . + .: 660 :TRDLLKTSRKFTLPLLETMDRERLTRRVGDNRVLV :Sequence :HHHHHTccHHHHHHHHHHHHHTTcEEEETTEEEEc :Sec Str :================================== :RP:SCP|585->634|1lvaA4|1e-07|44.0|50/60|a.4.5.35 :=================================== :BL:SWS|1->635|SELB_MOOTH|e-151|46.5|632/634 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|588->634|PF09107|1e-11|61.7|47/50|SelB-wing_3