[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50704.1"

            "L-lactate transport"
            ""

OrgPattern ------1-1111111------1-1-11--11------------11----------------------- -11--22-----1------------1------------1---------------121------1--1111-----------1------1111--11----1--------------------------------------11-----1--------------------------------------1-----121333333343333333122212333211-1-1------1-12222222222222211113-1------1-111----------------1----------------------------------------12--111111111131---1111-1---1--2-66-21--111---1--1-21---------11111--11111-11121-11111-11111112----------------11-------------11111111---11111------------------------------------11--211212-111-22121111-22212222--111-111121--1-221----1-1111111----11--1-111221-333-1-1--22-11111----1-11-111111112222222-------1-----1-111-111111-1111-21211-------1------211111-2112222222-12222232221222222211111---111-111111111111111113221------------------------------1-1111-1-11-11--111111-1--12111111111211122----------------3111111111111----------------------11111111----------------------------------------- -------------------------------------------------------------------------------------------------------222--------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMWEQIITPFENQYLSAFVASIPISFLFFTLYSRVRIHIAGFLTLLVTTGVAIFVYGMPF:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 61: . . . * . .: 120 :KLAAWSSFYGGMTGMFSIGWIMLSSLFLYKLTVKTGQIHIITWSIQSITRDHRLQCLLVA:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 121: . . + . . .: 180 :LCLGAFLENLAGYSTSVAITSGILVALGFRPIYAAVLCLITSISFGFMGVPIITAGLTSD:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 181: . * . . . .: 240 :IDMMAVSQMVGRQLPILSFLLPFWLVFILAGWKGTKEVWLPILVCGISFAGVQWFAANYI:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 241: + . . . . *: 300 :FLSIVNTLAAVTTMIIMVFFLRNWQPKDVWHSQKTSSFYPNEKISFSTVLSAWLPYIIMT:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 301: . . . . + .: 360 :IFIINWSFKPVQDFLNTFTVYVAVSTLNNTIIASGKPIEVYLSLSLLSSVGTVIFISAII:Sequence : XXXXXXXX :SEG|342->349|lslsllss :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 361: . . . * . .: 420 :NAYIYKVCHKELITLLGQAVRNLFLPLVGISLIIGVSYLMNWSGMIASMANVIASANGLL:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 421: . . + . . .: 480 :PMFAPILGWLGVFITGSDVSSNTLMAKLQANTAQIVGFDPVLTVAANHSGGAVAKMISPE:Sequence :============================================================:BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 481: . * . . . .: 540 :AIGAAASATGLNGREDDIFSYTLTHSLFFLSFLCFLTYLQAYTFKWLIPSYHKVLGITAE:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|499->519|fsytlthslfflsflcfltyl :================================================= :BL:SWS|1->529|LUTP_BACSU|3e-92|37.1|529/563 :$$$$$$$$$$$$$$$$$$ :RP:PFM|15->498|PF02652|8e-93|40.7|479/508|Lactate_perm 541: + . . . . *: 600 :MVNYKIEGYKLMILMLGLVLVLALFSSKLKGKDNKQNEHTNRVKTL :Sequence : XXXXXXXXXXXXXX :SEG|551->564|lmilmlglvlvlal