[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50753.1"

            "Extracellular ligand-binding receptor"
            ""

OrgPattern 22-2-1----------2-1222212--12-12----1--------1-3-----------1----1--- --1-3--1111---1------2---4------22221233233311---11-111--111335-112121422222111---3--------------------------------------------1-11--31-22244---4543253331222----1-3-212141------------8542211----11111------------------1-4311--------42------------------------11-----11--11---11----1-11---11111111111111-------------1111111111221-41111111-1---11----2-1--5--63223372-111---211211------1111-3PMI316F9JMF56575663656-45C53G5C331-A333345734348F1--4251322314--------7----726-----------------------------2--1--BJECFDDGCHE46665DDIC777757DEJAFBA-399AA2556BGH9DQ558----43----------9BI1D8322834D644623333153123333321E1--1-222222----------21----11121------------------1--1-1--------------3131-412222222222-22222222222222222224441111-2222222222212121322222221-111111111111-------------11213---------------------1-1-2-22222322222231222----------------------11----------------1---------------1---------------------------312--14111-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2---------------------1--3---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKHFRLAALLVALVMLAGLVSGCGGGGEEKKAADANEIVIGGNLELSGPVATFGTAMKN:Sequence : cEEEccEEEEEEEEccccTTHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|7->21|laallvalvmlaglv : XXXXXX :SEG|23->28|gcgggg : ========================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 : =======================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 : $$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 61: . . . * . .: 120 :GAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTM:Sequence :HHHHHHHHHHHHcEEcccEEEEEEEEcTTcHHHHHHHHHHHHHTTcccEEEEEccHHHHH:Sec Str :============================================================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :============================================================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 121: . . + . . .: 180 :GFMQVATDNKVPIITPSGTALEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKA:Sequence :HHHHHHHHHTcEEEEccccGGGTTcccccTTTcTTEEcccccHHHHHHHHHHHHHHHHcc:Sec Str :============================================================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :============================================================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 181: . * . . . .: 240 :KTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFMPEDQDFKATLTKIKGLNPDVI:Sequence :EEEEEEEcTTcHHHHTTHHHHHHHTGGGTEEEEEEEEccTTcHHHHHHHHHHHTTcccEE:Sec Str :============================================================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :============================================================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 241: + . . . . *: 300 :YVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIAGGAALNNTYFSNHYSSQKDD:Sequence :EEcccHHHHHHHHHHHHHHTcccEEEEcGGGccTTHHHHHcGGGTTcEEEEEccGGcTTc:Sec Str : ####################:PROS|281->305|PS00583|PFKB_KINASES_1|PDOC00504| :============================================================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :============================================================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 301: . . . . + .: 360 :PEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEALANAKDVQAI:Sequence :HHHHHHHHHHHTTccGGccHHHHHHHHHHHHHHHHHTTHHHHTHHHHHHHHHHccccTTc:Sec Str :##### :PROS|281->305|PS00583|PFKB_KINASES_1|PDOC00504| :============================================================:RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :============================================================:BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor 361: . . . * . .: 420 :TGKLSFDENHNPIKGAVILEMKDGKQVYKTYVQP :Sequence :cccccccTcccccccEEEEEEcTTccE :Sec Str :================= :RP:SCP|37->377|1usgA|2e-67|25.4|331/345|c.93.1.1 :=========================== :BL:SWS|38->387|LIVB3_BRUME|5e-36|30.4|339/368 :$$$$$$$$$ :RP:PFM|59->369|PF01094|4e-44|38.9|301/319|ANF_receptor