[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50753.1 dred0 ABO50753.1 "Extracellular ligand-binding receptor"
MKKHFRLAALLVALVMLAGLVSGCGGGGEEKKAADANEIVIGGNLELSGPVATFGTAMKN
GAEMYFEEVNAAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTM
GFMQVATDNKVPIITPSGTALEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKA
KTAVLYVDNQSPYAKGLAQFFKDSFIKQGGKIVGEEAFMPEDQDFKATLTKIKGLNPDVI
YVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIAGGAALNNTYFSNHYSSQKDD
PEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEALANAKDVQAI
TGKLSFDENHNPIKGAVILEMKDGKQVYKTYVQP
//