[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50761.1"

            "type III restriction-modification system methylation subunit"
            ""

OrgPattern ---------------------------------1--------1--11-----1-------------1- ---1-12----1-1-1------------------------------1------1--------21----------------1-----1-22---1-1------1----1------------------1---1--4-----1---1---------------------1-----------------------111--------1---1-1------------11----1-------1---------------------111--1-1-----1--------1------------------------------------1111----1--1--------------11--1---11---12----323-1-11----11--------2--3-1---1---------------------------1---------------1-1----------------------------------------------------------------1--11111111111111--12111111----------1-11-1---1-1--2-----21--1-11--1----1----1-----------1-2-11-----1-------1-1--4-1232222-----------2-----1-1-------1--1-----1---1-----------1---2---1----1--------1--1-------------2---11-1111111111111--------------------------------1-------121111--1112--1----------11----1-----------------1---------------------1-111111111--1------------------------1--------2----4-----1----------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDKLKMHSINKVEDNIKKIGELFPNAITEVIKGYREDGSPIIEQAIDFDVLRQELSSVLV:Sequence : :Sec Str : =:BL:SWS|60->223|T3MO_BPP1|4e-31|43.3|164/646 61: . . . * . .: 120 :EGPAERYQFTWPDKRKSILLANAPIAKTLRPYREESVDFDNTENLYIEGDNLDALKLLQE:Sequence : EEcccEEEEEccHHHHGGGccc:Sec Str : ==============:RP:SCP|107->215|1g60A|6e-06|25.3|75/239|c.66.1.11 :============================================================:BL:SWS|60->223|T3MO_BPP1|4e-31|43.3|164/646 121: . . + . . .: 180 :TYLGKVKMIYIDPPYNTGNDFIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHT:Sequence :c cEEEEEEccccccccccccccc HHHHHHH HHH:Sec Str : ####### :PROS|129->135|PS00092|N6_MTASE|PDOC00087| :============================================================:RP:SCP|107->215|1g60A|6e-06|25.3|75/239|c.66.1.11 :============================================================:BL:SWS|60->223|T3MO_BPP1|4e-31|43.3|164/646 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|126->215|PF01555|9e-14|60.9|64/218|N6_N4_Mtase 181: . * . . . .: 240 :DWLNMIYPRLKLAKDLLTEDGAIFISIDDNEVENLNLKSESSFPSLT :Sequence :HHHHHHHHHEEEEEEEEEEEcccEETTEEEEccHH :Sec Str :=================================== :RP:SCP|107->215|1g60A|6e-06|25.3|75/239|c.66.1.11 :=========================================== :BL:SWS|60->223|T3MO_BPP1|4e-31|43.3|164/646 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|126->215|PF01555|9e-14|60.9|64/218|N6_N4_Mtase