[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50761.1 dred0 ABO50761.1 "type III restriction-modification system methylation subunit"
MDKLKMHSINKVEDNIKKIGELFPNAITEVIKGYREDGSPIIEQAIDFDVLRQELSSVLV
EGPAERYQFTWPDKRKSILLANAPIAKTLRPYREESVDFDNTENLYIEGDNLDALKLLQE
TYLGKVKMIYIDPPYNTGNDFIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHT
DWLNMIYPRLKLAKDLLTEDGAIFISIDDNEVENLNLKSESSFPSLT
//