[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50766.1"

            "Peptidase M15A"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32---------------------------------3----------------------------------------------------------------------------------1-21--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEELFKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGL:Sequence : ========================================================:RP:SCP|5->74|1lbuA2|5e-12|28.6|70/130|d.65.1.1 : =======================================================:BL:SWS|6->78|YCBK_SHIFL|3e-05|36.1|72/182 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->70|PF08291|1e-12|51.6|64/103|Peptidase_M15_3 61: . . . * . .: 120 :YPSQCFVHVDVRGYCARWEG :Sequence :============== :RP:SCP|5->74|1lbuA2|5e-12|28.6|70/130|d.65.1.1 :================== :BL:SWS|6->78|YCBK_SHIFL|3e-05|36.1|72/182 :$$$$$$$$$$ :RP:PFM|7->70|PF08291|1e-12|51.6|64/103|Peptidase_M15_3