[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50796.1"

            "RNA polymerase, sigma-24 subunit, ECF subfamily"
            ""

OrgPattern -------------------------------------------------------------------- EIS1N43422243364446-45224734444475554624423335122221342114--747254754961111111--823-----DEGD-D33---22B5ADE4M6E---------------23221112232666B9111C442222221211------22231111------------221--11131677777366-66746624777677833397331--11-YA--------------------------------------------------111-------------------------------------3A526222332222351551221455--D1-33CC625313121-221--D-A2222-11-11-8665324334411111111113-34633636282-33356463475445335321314223111111111-1111-21------------------------------3433-233325444252333322233333225132233-1441122331234413311222111111111111323231--11--21----22-11-4116776DM161------------------------11222528734414544424333344333444---1123------11121111111111111-1111111111111111111111221111111111111111111111111111-211111111111--18-----111112211111111112111111------1---1344443646532332223---------11111333335323343375763331111--32442222--------212-------------------------11111111113C2 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQAL:Sequence :TccHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->94|1or7A2|2e-22|47.8|92/113|a.177.1.1 : ==========================================================:BL:SWS|3->189|RPOE_HAEIN|2e-32|38.4|185/189 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->89|PF04542|7e-13|51.5|66/70|Sigma70_r2 61: . . . * . .: 120 :PNFRGDSSFSTWIYHITVNVCRDELRKRQRRPTVSLDDNSSDSNNSNTYEIRSNDPGPEE:Sequence :HcccTcccHHHHHHHHHHHHHHHHHHHHcccccccccccc HHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXX :SEG|97->107|ddnssdsnnsn :================================== :RP:SCP|2->94|1or7A2|2e-22|47.8|92/113|a.177.1.1 :============================================================:BL:SWS|3->189|RPOE_HAEIN|2e-32|38.4|185/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|23->89|PF04542|7e-13|51.5|66/70|Sigma70_r2 121: . . + . . .: 180 :MLDRSETQAMIQACLNTLSDDYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQA:Sequence :HHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTcccccccc:Sec Str : =======================================================:RP:SCP|126->181|1k78A1|5e-10|23.2|56/63|a.4.1.5 : =========================:RP:SCP|156->200|1c9bA2|5e-06|17.8|45/109|a.74.1.2 :============================================================:BL:SWS|3->189|RPOE_HAEIN|2e-32|38.4|185/189 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|135->181|PF08281|2e-07|57.4|47/54|Sigma70_r4_2 181: . * . . . .: 240 :LKEKISKQMELITPAKRLAK :Sequence :HHHHHHHHHHHHHHHHHT :Sec Str := :RP:SCP|126->181|1k78A1|5e-10|23.2|56/63|a.4.1.5 :==================== :RP:SCP|156->200|1c9bA2|5e-06|17.8|45/109|a.74.1.2 :========= :BL:SWS|3->189|RPOE_HAEIN|2e-32|38.4|185/189 :$ :RP:PFM|135->181|PF08281|2e-07|57.4|47/54|Sigma70_r4_2