[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50796.1 dred0 ABO50796.1 "RNA polymerase, sigma-24 subunit, ECF subfamily"
MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQAL
PNFRGDSSFSTWIYHITVNVCRDELRKRQRRPTVSLDDNSSDSNNSNTYEIRSNDPGPEE
MLDRSETQAMIQACLNTLSDDYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQA
LKEKISKQMELITPAKRLAK
//