[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50877.1"

            "phosphoribosylformylglycinamidine synthase I"
            ""

OrgPattern --11--1-11111111-111111111111111111111111111112111111111111-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1---1-11-11---------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111-111111111-1211111111111111111111111111-111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--1111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----111111111111111111111111-1111111111111111111111111111-11-11111111-1111111111-11111121111111111-11-21-1111--1111121111171112211--1-11--1-1-1--1---111--111-1311111111111A11111112111111211-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCG:Sequence :cEEEEEccTTEEEHHHHHHHHHTTTcEEEEEEEcTTcccccccEEEEcEEcGGGGcccTT:Sec Str : ===========================================================:RP:SCP|2->227|1t3tA2|3e-23|26.2|221/262|c.23.16.1 :============================================================:BL:SWS|1->230|PURQ_CARHZ|4e-94|67.2|229/234 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->100|PF07685|1e-12|63.6|55/151|GATase_3 61: . . . * . .: 120 :AVARFSPVMSPVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVE:Sequence :HHHHTcTTHHHHHHHHHHTcEEEEcHHHHHHHHHTcccccEEEccccccccccEEEEEEc:Sec Str :============================================================:RP:SCP|2->227|1t3tA2|3e-23|26.2|221/262|c.23.16.1 :============================================================:BL:SWS|1->230|PURQ_CARHZ|4e-94|67.2|229/234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->100|PF07685|1e-12|63.6|55/151|GATase_3 121: . . + . . .: 180 :NDISPFTSLASRGSVIKVPIAHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNP:Sequence :ccccTTcTTccTTcEEEEEccccccEEEcccEEEEEcccccEEEEEEccTccEEEEEccc:Sec Str :============================================================:RP:SCP|2->227|1t3tA2|3e-23|26.2|221/262|c.23.16.1 :============================================================:BL:SWS|1->230|PURQ_CARHZ|4e-94|67.2|229/234 181: . * . . . .: 240 :NGSVNNIAGICNEQGNVLGMMPHPERCAEEILGNIDGQLIFKSLLETWQRRCG :Sequence :cccGGGEEEEEcccccEEEEccccTTTTcTTTTccTTcHHHHHHHHHHHHHHH :Sec Str :=============================================== :RP:SCP|2->227|1t3tA2|3e-23|26.2|221/262|c.23.16.1 :================================================== :BL:SWS|1->230|PURQ_CARHZ|4e-94|67.2|229/234