[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50885.1"

            "GMP synthase (glutamine-hydrolyzing)"
            ""

OrgPattern 1112--2222222222-311111342233233322333333332212222333232222222221-22 2211122111112111111-1111111111111111112211111111111111111111111111111111111111112212111111222211---111111111211-------111111-222222222222112122212123111122111121111212331121122221221221211221222333333332333333222222333222223222222222111111111111111222111111111-1112211111111-12321112111122222222222122222222222222111222111123122111111111121322222212112122211322121322222111121211311111212111112111122122222112-11112111112111111111111112222111111111122222222211122211111111111---------------111122111111111211112111111121111111212111122121122221122122221212222222222121221132421111111111222122222112111232222233333111222222222222111121211212132222222233222232111-11222------11111112222222222-222222222222222222211111111212222222222222212222222111111111111111112221222222112121111111111111111111111111121111111211111111122222222212221111112111111111111111111112122112211111-1-1------1------1------1------1-21121222231 1111111-311-11112111111111111111121111211121111112112111111111211111111111111-1111111111-11121131111211111-2212111111112111112-11251-11211111-1111111-1111111112641111111123322121191122131121221133231 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPS:Sequence : HHHcTcEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccEEEEccccccG:Sec Str : ====================================================:RP:SCP|9->197|1gpmA2|3e-42|46.6|189/205|c.23.16.1 : ====================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->188|PF00117|2e-21|32.8|177/185|GATase 61: . . . * . .: 120 :SVYGEKAPTVDPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNI:Sequence :GGTGGGHHHHHHHHHHccccEEEEEEccccHHHHHHcTTcccccccccccEEEEETTEEE:Sec Str :============================================================:RP:SCP|9->197|1gpmA2|3e-42|46.6|189/205|c.23.16.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->188|PF00117|2e-21|32.8|177/185|GATase 121: . . + . . .: 180 :LKNLTADEECWMSHGDRVEEVPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPK:Sequence :EEccccccccEEEEEEEEHHHHHHHHHHcHHHHHHHHHTHHHHHccEEEEEccccccccc:Sec Str :============================================================:RP:SCP|9->197|1gpmA2|3e-42|46.6|189/205|c.23.16.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->188|PF00117|2e-21|32.8|177/185|GATase 181: . * . . . .: 240 :GMEVLKSFLFDICGCSGSWSMGSFLDEAVKEVKQRVGNRQVLCALSGGVDSSVAAVLVHR:Sequence :cccccccccTTccccHHHHHHHHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHH:Sec Str :================= :RP:SCP|9->197|1gpmA2|3e-42|46.6|189/205|c.23.16.1 : ==========================================:RP:SCP|199->392|1gpmA1|2e-38|57.7|175/175|c.26.2.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$ :RP:PFM|11->188|PF00117|2e-21|32.8|177/185|GATase : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->390|PF02540|4e-13|33.7|166/208|NAD_synthase 241: + . . . . *: 300 :AVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVDASERFLGKLQGVTDPEQKRK:Sequence :HHHHHTTccGGGEEEEEccccHHHHHHHHHHHTcEEEEccHHHHHHHHTTcccHHHHHHH:Sec Str :============================================================:RP:SCP|199->392|1gpmA1|2e-38|57.7|175/175|c.26.2.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->390|PF02540|4e-13|33.7|166/208|NAD_synthase 301: . . . . + .: 360 :IIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVGGLPEDMKFDL:Sequence :HHHHHHHHHHHHHHHHHTHcTEEEEEcccHHHHHHTcccHHHcHHHHHHTcccccTTccc:Sec Str :============================================================:RP:SCP|199->392|1gpmA1|2e-38|57.7|175/175|c.26.2.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->390|PF02540|4e-13|33.7|166/208|NAD_synthase 361: . . . * . .: 420 :VEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT:Sequence :EEccTTccHHHHHHHHHHHHHHcTTHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHH:Sec Str :================================ :RP:SCP|199->392|1gpmA1|2e-38|57.7|175/175|c.26.2.1 : ============================:RP:SCP|393->513|1gpmA3|2e-26|52.9|121/121|d.52.2.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|209->390|PF02540|4e-13|33.7|166/208|NAD_synthase 421: . . + . . .: 480 :DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDV:Sequence :HHccHHHHHHHHHHHHccTTcccccccccGGGccccHHHHHHHHHHHHHHHTTcHHHHHT:Sec Str :============================================================:RP:SCP|393->513|1gpmA3|2e-26|52.9|121/121|d.52.2.1 :============================================================:BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|423->512|PF00958|1e-31|66.7|90/93|GMP_synt_C 481: . * . . . .: 540 :LGNISTRLVNEVAEINRVVYDITSKPPGTIEWE :Sequence :cHcccccccTTccccTTTTcccccccccHHHHH :Sec Str :================================= :RP:SCP|393->513|1gpmA3|2e-26|52.9|121/121|d.52.2.1 :================================= :BL:SWS|9->513|GUAA_CARHZ|0.0|69.1|505/509 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|423->512|PF00958|1e-31|66.7|90/93|GMP_synt_C