[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50894.1"

            "Protein-glutamate O-methyltransferase"
            ""

OrgPattern -----------------------11111-111---1--1111133-13-2422-1-1-11-------- 1221-----------11----1---1--------------2---2---1-------------1-1---------------1---12-------------1-1-2-52423-----------------111---21-22222---11112122--------------32231------------2-------211222222221222222111121222111111111111113------------------------------------------------------------------------------------------31123111111111111221---115--11131114213212111221--2124334-----3135631144225----------1-2242244721--1113322223531-211-2-444425---------22211734------------------------------1-211211-12223324222144352223132243422--11231422221421123121242-------1112232822215318633219AA7849255565962-1111-1111-1-1-------21-5---32-224111142222221122212311133---2241------11111111111111111-1111111111111111111---111111111111111111111111-1111--111111111111---1---------22512-----------------------1-1444444335334334444-----1---1111233333111332244444333------621122222222222211--------------------------2-12211111-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF:Sequence :HHHHHHHHHHHHHHHcccccGGGHHHHHHHHHHHHHHHTcccHHHHHHHHHHcTTcHHHH:Sec Str : ==========================================================:RP:SCP|3->65|1af7A1|3e-13|30.2|63/81|a.58.1.1 : ==========================================================:BL:SWS|3->255|CHER_BACHD|4e-61|43.9|253/257 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->53|PF03705|1e-06|37.3|51/57|CheR_N 61: . . . * . .: 120 :LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA:Sequence :HHHHccccccTTTTTTHHHHHHHHTHHHHHHccccEEEEEcccTTTHHHHHHHHHHHHHH:Sec Str :===== :RP:SCP|3->65|1af7A1|3e-13|30.2|63/81|a.58.1.1 : ======================================================:RP:SCP|67->254|1af7A2|2e-51|34.4|183/193|c.66.1.8 :============================================================:BL:SWS|3->255|CHER_BACHD|4e-61|43.9|253/257 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|67->248|PF01739|2e-39|48.6|181/195|CheR 121: . . + . . .: 180 :NGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVN:Sequence :ccccEEEEEEEccHHHHHHHHHTEEEGGGGTTccHHHHHHHEETcccEEEEcHHHHTTEE:Sec Str :============================================================:RP:SCP|67->254|1af7A2|2e-51|34.4|183/193|c.66.1.8 :============================================================:BL:SWS|3->255|CHER_BACHD|4e-61|43.9|253/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|67->248|PF01739|2e-39|48.6|181/195|CheR 181: . * . . . .: 240 :FKQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNY:Sequence :EEEccTTcccccccEEEEEEcccGGGccHHHHHHHHHHHGGGEEEEEEEEEcTTcccTTT:Sec Str :============================================================:RP:SCP|67->254|1af7A2|2e-51|34.4|183/193|c.66.1.8 :============================================================:BL:SWS|3->255|CHER_BACHD|4e-61|43.9|253/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|67->248|PF01739|2e-39|48.6|181/195|CheR 241: + . . . . *: 300 :AEIGFEKVSPCFYRKK :Sequence :cTETEEEEETTEEEE :Sec Str :============== :RP:SCP|67->254|1af7A2|2e-51|34.4|183/193|c.66.1.8 :=============== :BL:SWS|3->255|CHER_BACHD|4e-61|43.9|253/257 :$$$$$$$$ :RP:PFM|67->248|PF01739|2e-39|48.6|181/195|CheR