[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50894.1 dred0 ABO50894.1 "Protein-glutamate O-methyltransferase"
MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEF
LDYLTINVSEFFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIA
NGKRHQIDATDLDNTILQAAASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVN
FKQHNLLADTYPKGYDLIACRNVTIYFTREAQDKVNARFAQSLNPGGYLFIGGSETIFNY
AEIGFEKVSPCFYRKK
//