[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50917.1"

            "flagellar motor switch protein FliG"
            ""

OrgPattern -------------------------------------------------------------------- 1111------------------------------------1---1---1--1-1--------1-1------------------11111--------------------1------------------------------------1---------------------------------------------111111111111111111111111111111111111111111------------------------------------------------------------------------------------------12111111111111111111---111--1111111111--11111111--11111111----1121111112112------11--1-2222212211111111111111111-11111121221----------1111-121--------------------------------111111111111211111111111112121111111--111111111--111111111121-------111-11111-1111111111111111111111-1--1-1111-1111111111111111111---12-111111111211121211121122221---111111-11121111111111111111-12112111-1112-11--1---1111111111111111111111---111111122222222222---------1111--111-------------------------1111111111211111111---------1112211111221111111111112------113322232222222222--------------------------1-11111111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------1------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNQYEKLTGEQKAAILLISLGADVSSKLLKQEFTEDEVEKVTAAIAEMDKVPNDIQKQVV:Sequence : ccccccccccHHHH:Sec Str : ========================================================:BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 61: . . . * . .: 120 :EEFIYLIQARDYLLNGGVNYAKELLEKTYGYDKGSEILERISSTMQSVPFGSLRKTDPRH:Sequence :HHHHHHHHHHTcccHHHHHHHHHHHHHHHHHTTccccccEEEEEEEEEEEETTcTTHHHH:Sec Str : ====:RP:SCP|117->329|1lkvX|2e-61|54.0|213/213|a.118.14.1 :============================================================:BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 121: . . + . . .: 180 :ILSFIREEHPQTIAFVLSYLKPDQAAVILAELDSQLQSEVARRVAILDRISPDVAKEVEK:Sequence :HHHHHHTTTTTEEEEEEEEccccEEEEEEEEEEHHHHHHHHHHHHTcTTEEEEHHHHHHH:Sec Str : XXXXXXX:SEG|174->187|vakevekvlekkla :============================================================:RP:SCP|117->329|1lkvX|2e-61|54.0|213/213|a.118.14.1 :============================================================:BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 181: . * . . . .: 240 :VLEKKLASVAQHEETVVGGVQCLVNILNRVDRSTEKTIFEDLERADPNLSEEVRRLMFIF:Sequence :HHHHHHHHHHHHHHcccccHHHHHHHHHTccHHHHHHHHHHHHHHcHHHHHHHHHHHccG:Sec Str :XXXXXXX :SEG|174->187|vakevekvlekkla :============================================================:RP:SCP|117->329|1lkvX|2e-61|54.0|213/213|a.118.14.1 :============================================================:BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|220->327|PF01706|3e-28|58.3|108/110|FliG_C 241: + . . . . *: 300 :EDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYKNMSKRASEMLKEEIDYMGPV:Sequence :GGGGGccHHHHHHHHTTccHHHHHHHHTTccHHHHHHHHTTccHHHHHHHHHHHHccccc:Sec Str :============================================================:RP:SCP|117->329|1lkvX|2e-61|54.0|213/213|a.118.14.1 :============================================================:BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|220->327|PF01706|3e-28|58.3|108/110|FliG_C 301: . . . . + .: 360 :RLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV :Sequence :cHHHHHHHHHHHHHHHHHHHHTTccccccTccccccc :Sec Str :============================= :RP:SCP|117->329|1lkvX|2e-61|54.0|213/213|a.118.14.1 :===================================== :BL:SWS|5->337|FLIG_BACSU|2e-92|49.4|332/338 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|220->327|PF01706|3e-28|58.3|108/110|FliG_C