[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50917.1 dred0 ABO50917.1 "flagellar motor switch protein FliG"
MNQYEKLTGEQKAAILLISLGADVSSKLLKQEFTEDEVEKVTAAIAEMDKVPNDIQKQVV
EEFIYLIQARDYLLNGGVNYAKELLEKTYGYDKGSEILERISSTMQSVPFGSLRKTDPRH
ILSFIREEHPQTIAFVLSYLKPDQAAVILAELDSQLQSEVARRVAILDRISPDVAKEVEK
VLEKKLASVAQHEETVVGGVQCLVNILNRVDRSTEKTIFEDLERADPNLSEEVRRLMFIF
EDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYKNMSKRASEMLKEEIDYMGPV
RLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV
//