[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO50988.1"

            "S-layer domain protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5----------------------------------------------------------------------------------------------------------------------1---1--1121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKVGKGIITLAVASSLLVGGAMADAAPGGNGKGSSDKSSKPSSSQVQKSSSQSNSGTQN:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|29->62|ggngkgssdksskpsssqvqksssqsnsgtqnks 61: . . . * . .: 120 :KSVNGVEIKETKTNKANNDKKFGEVQSKVKYAAKDFKDTQNHWAKGPIQRLQMLGIASGF:Sequence :XX :SEG|29->62|ggngkgssdksskpsssqvqksssqsnsgtqnks : =====================================:BL:SWS|84->145|SLAP1_CLOTH|4e-08|38.7|62/2313 : $$$$$$$$$$$$$$$$$$:RP:PFM|103->135|PF00395|2e-05|45.5|33/45|SLH 121: . . + . . .: 180 :PDGTFQPEAPVTQEQVVSMVVRTLELQGEEINETTNETDEITTEQTEATEEELEDVPNWA:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|149->175|eeinettnetdeitteqteateeeled :========================= :BL:SWS|84->145|SLAP1_CLOTH|4e-08|38.7|62/2313 :$$$$$$$$$$$$$$$ :RP:PFM|103->135|PF00395|2e-05|45.5|33/45|SLH 181: . * . . . .: 240 :RGAVAEAKAKGIINLNRFHSGVQASRVQSMVWLAKAMDLEPVETTGLPFKDGILVSPEDM:Sequence : ====================================:BL:SWS|205->277|GUN_BACS6|3e-04|33.3|67/941 241: + . . . . *: 300 :GYVMALYKEGLVAGGPGGMLNPNSAVTRAQIAALIDRMLTEEQTEDTDTFQGVETADGQQ:Sequence : XXXXXXXXXX :SEG|280->289|teeqtedtdt :===================================== :BL:SWS|205->277|GUN_BACS6|3e-04|33.3|67/941 301: . . . . + .: 360 :VLKIGTGENAEEIKLADEVEIYINGELAELSDLVKGTAVKVETNEEGLAIKIEQTVEEST:Sequence : XXXXXX:SEG|355->377|tveestteddttveeetdntaen 361: . . . * . .: 420 :TEDDTTVEEETDNTAENSTEDTDNINS :Sequence :XXXXXXXXXXXXXXXXX :SEG|355->377|tveestteddttveeetdntaen