[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO50988.1 dred0 ABO50988.1 "S-layer domain protein"
MSKVGKGIITLAVASSLLVGGAMADAAPGGNGKGSSDKSSKPSSSQVQKSSSQSNSGTQN
KSVNGVEIKETKTNKANNDKKFGEVQSKVKYAAKDFKDTQNHWAKGPIQRLQMLGIASGF
PDGTFQPEAPVTQEQVVSMVVRTLELQGEEINETTNETDEITTEQTEATEEELEDVPNWA
RGAVAEAKAKGIINLNRFHSGVQASRVQSMVWLAKAMDLEPVETTGLPFKDGILVSPEDM
GYVMALYKEGLVAGGPGGMLNPNSAVTRAQIAALIDRMLTEEQTEDTDTFQGVETADGQQ
VLKIGTGENAEEIKLADEVEIYINGELAELSDLVKGTAVKVETNEEGLAIKIEQTVEEST
TEDDTTVEEETDNTAENSTEDTDNINS
//