[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO51003.1"

            "protein of unknown function DUF558"
            ""

OrgPattern -------------------------------------------------------------------- 111-1111111-11-----------1------1---111111-1--1-11111111-1--111111111111111111-11-11-111--1--111---11-1-111-11--------------11111111111111111---11111-11-11111111-111111111-11------1--111--111111111111111111111111111111111111111111111111111111111111111111-1-11-1----111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-11111-211111--11-----1------------------------------1--11-----------11-1-1-1---1-11111111---1--1-111--111-----1--1-------11-1-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111112111-11111-------------------------111-1111111111111111111111111111--111111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-12-----------------1----1-1------1111-----111-11---1---111 -----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1112-11--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEV:Sequence :ccEEEcccccEETTEEEEETHHHHHHHHHTTccTTccEEEEETcTEEEEEEEEEEcccEE:Sec Str :============================================================:RP:SCP|1->69|1nxzA1|1e-17|31.9|69/72|b.122.1.2 :============================================================:BL:SWS|1->247|RSME_HAEIN|9e-33|36.1|233/245 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->236|PF04452|2e-41|43.6|218/225|Methyltrans_RNA 61: . . . * . .: 120 :HCRILEQQEATSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAK:Sequence :EEEEEEEcccccccccEEEEEEEccccTHHHHHHHHHHHHTccEEEEEEcTTccccHHHH:Sec Str : ################ :PROS|99->114|PS00012|PHOSPHOPANTETHEINE|PDOC00012| :========= :RP:SCP|1->69|1nxzA1|1e-17|31.9|69/72|b.122.1.2 : ================================================:RP:SCP|73->247|1nxzA2|1e-33|32.9|170/174|c.116.1.5 :============================================================:BL:SWS|1->247|RSME_HAEIN|9e-33|36.1|233/245 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->236|PF04452|2e-41|43.6|218/225|Methyltrans_RNA 121: . . + . . .: 180 :KAAERVQRWQRVAVEAAKQCRRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLR:Sequence :HHHHHHHHHHHHHHHHHHHHTcccccEEcccEEGGGccccccEEEEEcTTcccccGGGcc:Sec Str :============================================================:RP:SCP|73->247|1nxzA2|1e-33|32.9|170/174|c.116.1.5 :============================================================:BL:SWS|1->247|RSME_HAEIN|9e-33|36.1|233/245 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->236|PF04452|2e-41|43.6|218/225|Methyltrans_RNA 181: . * . . . .: 240 :EVLQTRPMAPGQVYIFIGPEGGFEEEEVERVKEKGFYPVTLGSRILRTETAGPAALTMVL:Sequence :THccGcccTccEEEEEEccTTcccHHHHHHHHHTTcEEEccccccccHHHHHHHHHHHHT:Sec Str : XXXXXXXXXXXXXXXXX :SEG|200->216|eggfeeeevervkekgf :============================================================:RP:SCP|73->247|1nxzA2|1e-33|32.9|170/174|c.116.1.5 :============================================================:BL:SWS|1->247|RSME_HAEIN|9e-33|36.1|233/245 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|18->236|PF04452|2e-41|43.6|218/225|Methyltrans_RNA 241: + . . . . *: 300 :YQFGELG :Sequence :GGGTcTT :Sec Str :======= :RP:SCP|73->247|1nxzA2|1e-33|32.9|170/174|c.116.1.5 :======= :BL:SWS|1->247|RSME_HAEIN|9e-33|36.1|233/245