[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO51003.1 dred0 ABO51003.1 "protein of unknown function DUF558"
MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEV
HCRILEQQEATSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAK
KAAERVQRWQRVAVEAAKQCRRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLR
EVLQTRPMAPGQVYIFIGPEGGFEEEEVERVKEKGFYPVTLGSRILRTETAGPAALTMVL
YQFGELG
//