[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO51163.1"

            "protein of unknown function DUF47"
            ""

OrgPattern -------------------------------------------21112-------------------- -11-1-----------------------------------1---11--1-----------111----1111----1112111--------111------1-11--1---2-------------------------------111---------------------------------------111----12-1111111111111111--11111111112-1-11111121111111111111111111111---------------------------------------------------------------------1--11-------1-11-11-111--1--1--1-111112--1---11---1--1--1-------11111111111--------------1--1-1-1---11-1111111-----------------------------1---------------------------------111------1111111111111111111112111111111111111111111-112--1---------------1---------1---1-1111111-111111231----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFFKKTDIFFETFKAIAENITRAAEDFSAEIHNPSSDKRGLTNLQNYEKTGDRYTHTIIK:Sequence : =====:RP:SCP|56->201|1xwmA|8e-11|9.6|146/212|a.7.12.1 :============================================================:BL:SWS|1->204|YKAA_BACSU|1e-39|40.7|204/205 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->202|PF01865|6e-23|35.7|196/210|PhoU_div 61: . . . * . .: 120 :ELNKTFVTPLEREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQ:Sequence :============================================================:RP:SCP|56->201|1xwmA|8e-11|9.6|146/212|a.7.12.1 :============================================================:BL:SWS|1->204|YKAA_BACSU|1e-39|40.7|204/205 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->202|PF01865|6e-23|35.7|196/210|PhoU_div 121: . . + . . .: 180 :EVEKSIGKLVTKRFLEIRTHAVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYE:Sequence :============================================================:RP:SCP|56->201|1xwmA|8e-11|9.6|146/212|a.7.12.1 :============================================================:BL:SWS|1->204|YKAA_BACSU|1e-39|40.7|204/205 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->202|PF01865|6e-23|35.7|196/210|PhoU_div 181: . * . . . .: 240 :MLEEVTDACEDVANILESILMRNS :Sequence :===================== :RP:SCP|56->201|1xwmA|8e-11|9.6|146/212|a.7.12.1 :======================== :BL:SWS|1->204|YKAA_BACSU|1e-39|40.7|204/205 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->202|PF01865|6e-23|35.7|196/210|PhoU_div