[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO51163.1 dred0 ABO51163.1 "protein of unknown function DUF47"
MFFKKTDIFFETFKAIAENITRAAEDFSAEIHNPSSDKRGLTNLQNYEKTGDRYTHTIIK
ELNKTFVTPLEREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQ
EVEKSIGKLVTKRFLEIRTHAVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYE
MLEEVTDACEDVANILESILMRNS
//