[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO51269.1 dred0 ABO51269.1 "hypothetical protein"
MIIILMVGWIIGSFLPGERQATHRVQEFIDAVNDNRPRDIYLYLTPQLREKISREDFTRN
FAKERSYPYLTPLYLYLDEVKLSPDKQTGEAILTVAARLPGEKMRVHLVYYRGHYYIEAF
KEIVDGSYQDKFQKLKR
//