[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "dred0:ABO51527.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1------------1---3----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTIFFALFERTFFMDKVMDYIQALTNLYGVVHKDKVQEIYNQQNDDKIDDKSMEYIIKEK:Sequence : cccEEEEEEEEEEEEETT EEEEEEE:Sec Str : ==========================:BL:SWS|35->148|P115_MYCHR|5e-05|22.1|104/979 61: . . . * . .: 120 :KDYLINHRQITVHKDYFVYLSIMVAGSYFDEELRAKEGKPYYIPEKEELLKYKDVNYFEV:Sequence :EEEEcccEEEEEcTTEEEEEEEEEEcGGGHHHHHHHcTTcEEETTccccEEEEEEEE :Sec Str :============================================================:BL:SWS|35->148|P115_MYCHR|5e-05|22.1|104/979 121: . . + . . .: 180 :NKEYEELLQFLKKMFWRKSKAEDVAREIQMHCESFRAMENLHLLFEEKKIRFKNAKQADE:Sequence : :Sec Str :============================ :BL:SWS|35->148|P115_MYCHR|5e-05|22.1|104/979 181: . * . . . .: 240 :LMRLIRNLANNTRIWQNNGYTPNELDVGKR :Sequence : :Sec Str