[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABO49055.1 dred0 ABO49055.1 "conserved hypothetical protein"
MTKTLELIFVNVAGDKVTLRVNDPRDDLQEAEVRTVMDTVVAKNVFTSTGGSLTGVAGAR
LVTRDVAELNIL
//