[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54042.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDLKQEVSLSALKRGKAPAYPVKTSINLVDTQQQRGNLLAQLGLFAIALVLIGVFAKFAV:Sequence 61: . . . * . .: 120 :VDPLAASAASSNEVSAAQARLDVLAAENADYAELNAQYDRYVVPGLSEEEQNLVDRDVVL:Sequence : XXXXXXXXXXXXXXX :SEG|65->79|aasaassnevsaaqa : XXXXXXXXXX:SEG|111->125|qnlvdrdvvlnllqq 121: . . + . . .: 180 :NLLQQKVMGVGHLSSLRMEKNTATVTCLGADLNEVSALVESLESDQRVAHVTVSTAQGEN:Sequence :XXXXX :SEG|111->125|qnlvdrdvvlnllqq 181: . * . . . .: 240 :DSSTSATIQIVFAGPLDVEGDGGSKEKGAGDGAA :Sequence