[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54068.1"

            "transcriptional regulator, BadM/Rrf2 family"
            ""

OrgPattern -------------------------------------------------------------------- -1--------------------------------------1---------------------1----------------11-1----------------------------------------------1-----1---1------1------1--1--------1111--------------11111-1---------------------1111------------------------------------------------------------------------------------------------------------1----2222222-2-----------2-------1111----11---2-1-1-------------------------------------------------11---1-----1------1----------------11----1--------------11------11----------1---------------------------------------1-1-------------1----------------1------11-----1--1---1111111-1-1-------------------1------11-----1----------------------------1--------11-1------------------------------------111-----------------------------------------------1111-------------------------------1--------------------------1----------------1-1-1-11----------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKH:Sequence : HHTccHHHHHHHHHHTcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccc:Sec Str : ##############:PROS|47->65|PS01332|HTH_RRF2_1|PDOC01035| : ===================================================:RP:SCP|10->84|1f6vA|1e-07|22.7|66/91|a.49.1.1 :============================================================:BL:SWS|1->82|NSRR_PROMH|2e-12|37.8|82/142 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->81|PF02082|2e-14|43.2|81/83|Rrf2 61: . . . * . .: 120 :GGYRLAKDPADTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEESMDAYL:Sequence :cEEEEcccccccHHHHHHHHHHHHHHHTc cHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :##### :PROS|47->65|PS01332|HTH_RRF2_1|PDOC01035| :======================== :RP:SCP|10->84|1f6vA|1e-07|22.7|66/91|a.49.1.1 :====================== :BL:SWS|1->82|NSRR_PROMH|2e-12|37.8|82/142 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->81|PF02082|2e-14|43.2|81/83|Rrf2 121: . . + . . .: 180 :SSLTVQMLLDCARNGDNSRTFLAERLQEESRRLLDAVK :Sequence :TTccHHHHcc :Sec Str