[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54171.1"

            "urea amidolyase related protein"
            ""

OrgPattern ------------------------------------------------------1111111------- --2-21-21111-121111-11111211111112221454111-2111-22-322112--11211112111--------11----------------------11-------------------------------111-----11---1----------------1----------------11-11---2-1111-1111111111111111111111111--------1222222222222222222222-------1-------------1-------------------------------------------------1--1-----------111---------1--1-----1--11-111-11----111------1231211122212------------22122222--1-5224222432--2211-112111112121222222111111-1-----------------------------1-1---221121223312222222222222112321321--112--1--21-223--11--1-----1111221-11--1-1-----------------------11-1-----11111-----------11------211211-1111111-------1----12-----11------1235-121111111111-11111111111111111111214311111111111111111112111---1--111111111111---1---------11-11-------111--11-22222111-11233331224322221443111-11111111111111111111--1--------------------------------------------------------------------1- ---------------1-11111121-1----------------111---21222111-----211111111121111--1111111---111-----11-1---------------------------------------------------------------------------11-----11----1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGLVVKKPGVITTIQDVGRFGYQGSGFSTNGVMDHRAFAIANLLVENDPGAPVLEFALAG:Sequence : ========================================================:BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->300|PF02626|1e-58|48.7|267/271|AHS2 61: . . . * . .: 120 :PTVRFTTNTCFAITGGDFAPTLDGEPVPMYAAVMVRRGSILRFKASRTGCYGYLAIAGNS:Sequence :============================================================:BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->300|PF02626|1e-58|48.7|267/271|AHS2 121: . . + . . .: 180 :VRVPEVMGSRSTNLKCEFGGWKGRTLIVGDYLPFSTKSVDFLPNLGSHRIDGDNEFYGFD:Sequence :============================================================:BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->300|PF02626|1e-58|48.7|267/271|AHS2 181: . * . . . .: 240 :RDEITVRVVPGPQQDMFTDKGLATFYGQAYTTTTKCDRMGYRLDGPEIETKHGSDIISDG:Sequence :============================================================:BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->300|PF02626|1e-58|48.7|267/271|AHS2 241: + . . . . *: 300 :VAFGAVQVPSHGRPIIMLADRQTTGGYAKIGTIASVDIPKLVQRPPGGKIRFESIGVQEA:Sequence :============================================================:BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->300|PF02626|1e-58|48.7|267/271|AHS2 301: . . . . + .: 360 :QALLREEAHLFEMLALKVRRPSADGISPRRTARRLTPILEEQARKSQADMLWIDRADRSQ:Sequence :============= :BL:SWS|5->313|KIPA_BACSU|1e-55|41.5|306/335 361: . . . * . .: 420 :RVGNRNALGTVPPKKQPPDATDTTERATT :Sequence