[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54171.1 elen0 ACV54171.1 "urea amidolyase related protein"
MGLVVKKPGVITTIQDVGRFGYQGSGFSTNGVMDHRAFAIANLLVENDPGAPVLEFALAG
PTVRFTTNTCFAITGGDFAPTLDGEPVPMYAAVMVRRGSILRFKASRTGCYGYLAIAGNS
VRVPEVMGSRSTNLKCEFGGWKGRTLIVGDYLPFSTKSVDFLPNLGSHRIDGDNEFYGFD
RDEITVRVVPGPQQDMFTDKGLATFYGQAYTTTTKCDRMGYRLDGPEIETKHGSDIISDG
VAFGAVQVPSHGRPIIMLADRQTTGGYAKIGTIASVDIPKLVQRPPGGKIRFESIGVQEA
QALLREEAHLFEMLALKVRRPSADGISPRRTARRLTPILEEQARKSQADMLWIDRADRSQ
RVGNRNALGTVPPKKQPPDATDTTERATT
//