[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54358.1"

            "fumarate reductase/succinate dehydrogenase flavoprotein domain protein"
            ""

OrgPattern ------------------------------1------------------------------------- --------224---11211-11--111-111------423---2----------1-------1----------------AnD-----------------------------------------------------------------------------------------------------------------------------------------------111111------------------11---1-2---13-13311-1----1---1--------22---------------------------------2-73-2------------------23-1------HB-----1-------1-----------------1-------------------------1--1---1--------------1----------------------------------------------------------42--2--------1---------1---------12-----------------------------------------1-------------11131-1--21-2---------------------------------1------1-1-21--122-211-1121----------------21-11------------------------------22221------------------------------------------------------------------------------------2----------1111-----------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MITKGTAFDRRSFLKGAMLAGAGTAAFGLAGCAANGGGASGGASSNASASSGTAGQLSAE:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|16->55|gamlagagtaafglagcaangggasggassnasassgtag 61: . . . * . .: 120 :AISKGTWAFEIAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQ:Sequence : ccTTcccccccccccccEEccEEEEcccHHHHHHHHHHHHHTccEEEEccccc:Sec Str : ===================================:RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 : =====================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 121: . . + . . .: 180 :PVARGGSNHGIGTKFHERLGITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTM:Sequence :ccccTTGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 181: . * . . . .: 240 :NWLIDLMEAKGYTTTMEIGYTDTEGVFTAHPGSHNWVEQADGKESGAATGENLVIAMYEE:Sequence :HHHHHTTccHHHHHHHHHHHHHTTcccEEEccTTcccccEEEccccccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 241: + . . . . *: 300 :KIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNYVKYVGRKAIVLATGDFSANQ:Sequence :HHHHTTcEEEccEEEEEEEEcccccccEEEEEEEETTTEEEEEEEccEEEEcccccTTcH:Sec Str :============================================================:RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 301: . . . . + .: 360 :DMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTLPNAPMIDAVG:Sequence :HHHHHHcGGGTTcEEcccTTccccccccTTcccHHHHHHHTTTccEEcTTcEEEEEcTTT:Sec Str :============================================================:RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 361: . . . * . .: 420 :PMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW:Sequence :cccccTHHHHTTcEEEcccccccccTTccHHHHHHHHHTcTTccEEEEEEHHHHHHcTHH:Sec Str :====================================== :RP:SCP|86->398|1d4cA2|2e-18|19.8|283/322|c.3.1.4 : ================================================:RP:SCP|373->519|1d4cA3|5e-16|26.3|118/146|d.168.1.1 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 421: . . + . . .: 480 :ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVE:Sequence :HHHTTHHHHHHTTccEEEccHcTHHHHHHHTTccEEEccHHHHHHHHHTccHHHHHHHHH:Sec Str :============================================================:RP:SCP|373->519|1d4cA3|5e-16|26.3|118/146|d.168.1.1 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 481: . * . . . .: 540 :RYNELCEAKYDDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQ:Sequence :HHHHHHHHTcccccccccccccccccccccEEEEEEEEEEEEEEccEEEccTTcEEcTTT:Sec Str :======================================= :RP:SCP|373->519|1d4cA3|5e-16|26.3|118/146|d.168.1.1 :============================================================:BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2 541: + . . . . *: 600 :NEPIEGLYNLGIMVGDSYANCYNFAICGHNLGMNCNTFAYMLGKDLAEA :Sequence :ccEEEEEEEccTTEEcccTTccTTcccTTHHHHHHHHHHHHHHHHHHH :Sec Str :=============== :BL:SWS|68->555|FRD2_SHEFN|1e-21|28.2|419/588 :$$$$$$$$$$$$$$$ :RP:PFM|88->386,461->555|PF00890|8e-15|32.0|328/375|FAD_binding_2