[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54358.1 elen0 ACV54358.1 "fumarate reductase/succinate dehydrogenase flavoprotein domain protein"
MITKGTAFDRRSFLKGAMLAGAGTAAFGLAGCAANGGGASGGASSNASASSGTAGQLSAE
AISKGTWAFEIAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQ
PVARGGSNHGIGTKFHERLGITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTM
NWLIDLMEAKGYTTTMEIGYTDTEGVFTAHPGSHNWVEQADGKESGAATGENLVIAMYEE
KIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNYVKYVGRKAIVLATGDFSANQ
DMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTLPNAPMIDAVG
PMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVE
RYNELCEAKYDDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQ
NEPIEGLYNLGIMVGDSYANCYNFAICGHNLGMNCNTFAYMLGKDLAEA
//