[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54398.1"

            "Phenylacetate--CoA ligase"
            ""

OrgPattern ---1--2222222122-------32-------223---333334327334544--------------- -1--2--1--1---1------1--------------1132-1-2--------112111----1-113111---------2433-----2223-2------1111-111------------------1-11--11--22211222-1-------------------------------------211221--1------------------1--------11--1-------2-------------------------------------------------------------------------------------------3------------1-5---1---2-2-12--52213241--23---3----31---1-------1211--33425--------------1--2--1---1-----2------2-1-111--11-11--------1----3-3--------------------------------1--232322222221111122111111122222221--11123-113-1322--2----1--------211523-455467657555513432553442222-317---------------------21----------1-1-1-----11----------13---111--------------1---1---11--111---1-1-----1--1111---------------------1--------------------------------------1---------------11111------1----11---1111--------------------------------------1--------------------------------------------------1---------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKDIPYDQKYYDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDI:Sequence : HHHHHHTcEEEEEcTTccHHHHHHHHHHTTccEEEEcccHHHHHHHHTcH:Sec Str : ================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 61: . . . * . .: 120 :ESLDDIAKFPFCDKKTERETQHVGSFFGEMCSVPEEEVIFMATSSGSTGVPTVSPFTQED:Sequence :HHTccccEEEEHHHHEETTEEcccccccccccccTTcEEEEEEEcccccccEEEEEEGGG:Sec Str : XXXXXXXXXXXXX :SEG|103->115|tssgstgvptvsp :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 121: . . + . . .: 180 :FDLWQDTEARLFWQAGMRPNDRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLL:Sequence :HHHHHHHHHHTTccccccTTcEEEEcccTTcHHHHTTTHHHHHTTcEEEEcccccHHHHH:Sec Str : ================================================:RP:SCP|133->365|1t5dX|6e-16|17.8|230/502|e.23.1.1 :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->357|PF00501|1e-08|27.5|204/405|AMP-binding 181: . * . . . .: 240 :FVLKQYQPTIIWTSPSYAWHLGEIAKEKGFDPKEDFNIHTIIVAGEAGGSIKSTREAIEN:Sequence :HHHHHTTccEEEccHHHHHHHHHHHHHHHHccTcccTTccEEEEccTTccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|133->365|1t5dX|6e-16|17.8|230/502|e.23.1.1 :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->357|PF00501|1e-08|27.5|204/405|AMP-binding 241: + . . . . *: 300 :LWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVETVDPTTGEVLAPGETGELVYT:Sequence :HcccEEEEEEEETTTEEEEEEEccTTEEcccTTccEEEEcTTccTTccccccccEEEEEE:Sec Str :============================================================:RP:SCP|133->365|1t5dX|6e-16|17.8|230/502|e.23.1.1 :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->357|PF00501|1e-08|27.5|204/405|AMP-binding 301: . . . . + .: 360 :TLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVNVFPSDIEYVV:Sequence :ccTTcccccTTcHHHHHHHEETTEEEEEEEEEEcTEEEETTTcEEETTEEEcHHHHHHHH:Sec Str :============================================================:RP:SCP|133->365|1t5dX|6e-16|17.8|230/502|e.23.1.1 :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|136->357|PF00501|1e-08|27.5|204/405|AMP-binding 361: . . . * . .: 420 :RGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI:Sequence :TTcTTEEEEEEEEEEcccccEEEEEEEEcTTccccHHHHHHHHHHccccGGGcccccEEE:Sec Str :===== :RP:SCP|133->365|1t5dX|6e-16|17.8|230/502|e.23.1.1 :============================================================:BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437 421: . . + . . .: 480 :VYDAGKLGTSSEHKASRFIDERGCVTR :Sequence :EcccccccccTTccccH :Sec Str :========================= :BL:SWS|13->445|PAAK_ECOLI|2e-51|34.3|420/437