[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54452.1"

            "DMSO reductase anchor subunit (DmsC)"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------242---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-1--211121-112-122121122211122222-212-----222122222222221212212221---11111111111------------------111----1111---1----------------------------------------111-----11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MISGFDTALGEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAM:Sequence : ==================================================:BL:SWS|11->292|DMSC_ECOLI|3e-15|28.8|274/287 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->246|PF04976|3e-15|33.5|233/272|DmsC 61: . . . * . .: 120 :VGLVASATHLGNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQR:Sequence :============================================================:BL:SWS|11->292|DMSC_ECOLI|3e-15|28.8|274/287 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->246|PF04976|3e-15|33.5|233/272|DmsC 121: . . + . . .: 180 :AWLVLAMLAGAVFVAAVGCAYAADTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYE:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|123->143|lvlamlagavfvaavgcayaa :============================================================:BL:SWS|11->292|DMSC_ECOLI|3e-15|28.8|274/287 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->246|PF04976|3e-15|33.5|233/272|DmsC 181: . * . . . .: 240 :PVEGRMGRVLTMVAAAALAVNVVTFGVQGADLASIENSYLTAAELVPSYGLMVCAFGVLG:Sequence : XXXXXXXXXXXXXXXX :SEG|189->204|vltmvaaaalavnvvt :============================================================:BL:SWS|11->292|DMSC_ECOLI|3e-15|28.8|274/287 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->246|PF04976|3e-15|33.5|233/272|DmsC 241: + . . . . *: 300 :MAGIGLDAVELWPRRVRLSVGRAAGAAVLVLAGIFVMRFAFYMMHMTVGLGV :Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|254->273|rrvrlsvgraagaavlvlag :==================================================== :BL:SWS|11->292|DMSC_ECOLI|3e-15|28.8|274/287 :$$$$$$ :RP:PFM|11->246|PF04976|3e-15|33.5|233/272|DmsC