[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV54452.1 elen0 ACV54452.1 "DMSO reductase anchor subunit (DmsC)"
MISGFDTALGEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAM
VGLVASATHLGNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQR
AWLVLAMLAGAVFVAAVGCAYAADTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYE
PVEGRMGRVLTMVAAAALAVNVVTFGVQGADLASIENSYLTAAELVPSYGLMVCAFGVLG
MAGIGLDAVELWPRRVRLSVGRAAGAAVLVLAGIFVMRFAFYMMHMTVGLGV
//