[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54491.1"

            "transcriptional regulator, LuxR family"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------8*C----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDERGSSPLALAIREVPGIAIASIGFGCALLAIEGDRLSTIRTVNISGDYHAVASLVSF:Sequence : :Sec Str 61: . . . * . .: 120 :LLLIMLALAYRKLDAPTHVPAAIVIGAGALMSASMFVVLQQSVWEDNPIVSSIARIVFGL:Sequence : :Sec Str 121: . . + . . .: 180 :GEGVILFLWMKALFPYGARACAAVLGLGTIVVAAMNSLIAFLKVDAAYGTVSLLPIVSMV:Sequence : :Sec Str 181: . * . . . .: 240 :LLCYFREYARSRAPRADRDDIPSEDACASPERSMVAGIGCPDRSLIVPSDQAPRGRRVFV:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|189->200|arsrapradrdd 241: + . . . . *: 300 :VTMMLSLACYAVVFGHIHYQWIPLQDGGTVSLIIQLGTAVGTACGGAAILVLVQYFWNRR:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|277->288|gtavgtacggaa 301: . . . . + .: 360 :SLELYKVFLIPTVLLALWLSSFVNETWIFLYLVLLNITQKLVFLFIMLAPFLIESKRPYL:Sequence : :Sec Str 361: . . . * . .: 420 :MPWCVAFLSFTAGKAASSLLLEHMSPDVFVSSSVIALVVLFACGAITSLSGSITDYHTPI:Sequence : :Sec Str 421: . . + . . .: 480 :RGQWPGPDAPDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLV:Sequence : HGGGccGGGTTTHHHHHHHHccTTTcccHHHHHHHHHHHTTccHHHHHHHHT:Sec Str : ==============================:RP:SCP|451->511|1h0mA1|1e-12|24.6|61/65|a.4.6.2 : ===================================:BL:SWS|446->506|YGEK_ECOLI|7e-09|44.3|61/210 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|455->506|PF00196|6e-08|46.2|52/57|GerE 481: . * . . . .: 540 :ITQSTAKTHLRNIYAKMDVHNQQEILNLVEQTIDEQKKA :Sequence :ccHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHcE :Sec Str :=============================== :RP:SCP|451->511|1h0mA1|1e-12|24.6|61/65|a.4.6.2 :========================== :BL:SWS|446->506|YGEK_ECOLI|7e-09|44.3|61/210 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|455->506|PF00196|6e-08|46.2|52/57|GerE