[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54505.1"

            "transcriptional regulator, LuxR family"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------2N3----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPALRRSIQSSARELARVIARDGAASFVLAVVGLACCFVFCSMGSSVETVAMRSSELFAP:Sequence : :Sec Str 61: . . . * . .: 120 :SGQADALPTFAVTAGSLAAYALFGWAPLRAVDRVRGSMPVYAVCCVALAAVYAVTSLPVL:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|100->114|vyavccvalaavyav 121: . . + . . .: 180 :SDASGARALLLVLRGFLGVTTLVSWFALLGDRPRLFQVSAIAVAFAATALADLAFLALQA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXX:SEG|160->197|aiavafaataladlaflalqaavgfallvalpllslga 181: . * . . . .: 240 :AVGFALLVALPLLSLGAYRVVARKRSGAGAAAAAPAGAASAAAVGDAEPSRAASGGVARV:Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|160->197|aiavafaataladlaflalqaavgfallvalpllslga : XXXXXXXXXXXXXXXXXXXXX :SEG|207->227|gagaaaaapagaasaaavgda 241: + . . . . *: 300 :LGSPILFCLLAGAVLGCIQGVGADLVLAHEQLAGGYVANNLLVAAALAIAAALVGGGAAF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX:SEG|277->307|vannllvaaalaiaaalvgggaafahdgdda 301: . . . . + .: 360 :AHDGDDARLLAYARLTVIVALVLALCLANVLMMSGTFVSLTAAKLIGALLLAYAWFAACA:Sequence : :Sec Str :XXXXXXX :SEG|277->307|vannllvaaalaiaaalvgggaafahdgdda : XXXXXXXXXXXXXXXXXXX :SEG|313->331|arltvivalvlalclanvl 361: . . . * . .: 420 :RPGARAVRALTRMLVCWQVAAALLQAAVMAMAGEGPVQVVNVIVVILLGAVLVMQLFPLF:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|378->392|qvaaallqaavmama : XXXXXXXXXXXXXXXXX :SEG|397->413|vqvvnvivvillgavlv 421: . . + . . .: 480 :LSSRPATFPTGPSNGQTRSQALSISADEADLALVERFADEYGLTPRERELLGFFAQGYSV:Sequence : ccccHHHHHHHHHHHTTccH:Sec Str : ==================:RP:SCP|463->520|1yioA1|1e-10|29.3|58/70|a.4.6.2 : ==================:BL:SWS|463->515|MOAR_KLEAE|2e-07|43.4|53/227 : $$$$$$$$$$$$$$$$$$:RP:PFM|463->514|PF00196|4e-07|44.2|52/57|GerE 481: . * . . . .: 540 :AYASEQLVLSPYTVRTHLRNIYVKTDTHSRDDLLALLKTY :Sequence :HHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHTT :Sec Str :======================================== :RP:SCP|463->520|1yioA1|1e-10|29.3|58/70|a.4.6.2 :=================================== :BL:SWS|463->515|MOAR_KLEAE|2e-07|43.4|53/227 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|463->514|PF00196|4e-07|44.2|52/57|GerE