[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54563.1"

            "transcriptional regulator, LuxR family"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------6v9----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQQATGGEKSRVVAKPARSDIQRGGIALDAFASALFWGYVAIMFGSSEIKIAESIGLAPE:Sequence : :Sec Str 61: . . . * . .: 120 :NVALICGNVVALVAVGLLGPRAHGSHLFVLGLAGSGTACILQTVSLLSPEMVPVAWSRLF:Sequence : :Sec Str : XXXXXXXXXXX :SEG|69->79|vvalvavgllg 121: . . + . . .: 180 :ACGASAILVLAWCEHISSETSQERPLFLALCSLLTIVIVLVSIQLGARSAILFGGVLPVV:Sequence : :Sec Str : ============================:BL:SWS|153->227|RER1C_ARATH|6e-04|36.9|65/212 181: . * . . . .: 240 :SAALGAYRTRASARTAPSVTIQPPFPLYLIVILFVFGFMISFFSLLNRRTGTVENFMIPA:Sequence : :Sec Str :=============================================== :BL:SWS|153->227|RER1C_ARATH|6e-04|36.9|65/212 241: + . . . . *: 300 :GIDPFLAGWTVLVLVIAGCVWMLLPQRHASLVTTVLIPLASLGLLLPPFLRYGLQETLPA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|276->294|liplaslglllppflrygl 301: . . . . + .: 360 :VVAFIVICEAIICSVGPSNAKKYFHIGSFTFVFWTRSFGLIGMIVGYAAAILLFDIMKIA:Sequence : :Sec Str 361: . . . * . .: 420 :IDFDILLIMFAAYAILCLTVAVMLGRIGLKAPAERERESTPAAAAHALAERYGLTAREAE:Sequence : ccccccccccEEEETTTEEEEcccHHHHTTcccHHHHH:Sec Str : ===========:RP:SCP|410->470|1h0mA1|2e-11|18.0|61/65|a.4.6.2 : =========================:BL:SWS|396->471|DESR_BACSU|4e-07|38.2|76/199 : $$$$$$$:RP:PFM|414->465|PF00196|4e-06|44.2|52/57|GerE 421: . . + . . .: 480 :VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEELAR :Sequence :HHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHc :Sec Str :================================================== :RP:SCP|410->470|1h0mA1|2e-11|18.0|61/65|a.4.6.2 :=================================================== :BL:SWS|396->471|DESR_BACSU|4e-07|38.2|76/199 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|414->465|PF00196|4e-06|44.2|52/57|GerE