[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV54634.1"

            "protein of unknown function DUF917"
            ""

OrgPattern -------22222-22-11--------------------------------------11---------- -------------------------------------2---------2-2----1-------2---3-------------2----------------------------------------------------------------1---------------------------------------------------------------22----------2---11111-----------------------1----1---------11---------------------------------------------------------------------1----------------11-3---12122-----------1-------111----------------------------21--2222--------1-11-------------------------1---------------------------------2------------------------------------------------------------------------------------------------------1-------------------------------------1--------------------1-----------------------------------------------------11---------------------------2---------------1--------------------------------------------------------1--------------------------------------------------------------------------------------------1------ -------------1-11311--12222111111222222211211111132353211---11---11-----111--------------1111-1-1-1----------13-----------------------------------------------------1--------11--------11---11--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKIGIQEIEDIALGATLLGAGGGGDPYIGKLTAIGAVKECGEVELIGIDEVPDGAFIMP:Sequence : XXXXXXXXXXXXX :SEG|13->25|algatllgagggg : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 61: . . . * . .: 120 :AASMGAPTILAEKGVGANEFAKLFDMVSRYYGKPIYATMPIEAGGVNSMLPIAAAARLGI:Sequence : ================================:RP:SCP|89->359|2o3iA1|1e-23|23.1|251/376|e.73.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 121: . . + . . .: 180 :PMVDVDGMGRAFPELQMVTFTIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMT:Sequence :============================================================:RP:SCP|89->359|2o3iA1|1e-23|23.1|251/376|e.73.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 181: . * . . . .: 240 :MGGTLTVALFCMDVDTCKQYGVHGIVTRSEELGRAIRTAKDEAAAAGLTPEEFFLKFTGG:Sequence :============================================================:RP:SCP|89->359|2o3iA1|1e-23|23.1|251/376|e.73.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 241: + . . . . *: 300 :HKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVDFQNENLSCVVDGQIKATVPD:Sequence :============================================================:RP:SCP|89->359|2o3iA1|1e-23|23.1|251/376|e.73.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 301: . . . . + .: 360 :LICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFGIDTDYIPVEE:Sequence :=========================================================== :RP:SCP|89->359|2o3iA1|1e-23|23.1|251/376|e.73.1.1 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|26->358|PF06032|5e-79|47.1|329/354|DUF917 361: . . . * . .: 420 :RSARKEA :Sequence